PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG667500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 24099.6 Da    PI: 7.217
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG667500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.78.6e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien++nrqvtfskRrngilKKA E+SvLCdaev v+ifss gkly+++s
  Pavir.5KG667500.1.p  9 KRIENSTNRQVTFSKRRNGILKKAREISVLCDAEVGVVIFSSAGKLYDFCS 59
                         79***********************************************96 PP

2K-box72.31.5e-2471167197
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                          yq++sgk l+++k++sl+ e++++kke++++q e+Rhl+GedL+sL+ keL  +e++L+++l++  +k +e++  ++++ ++ e+e++  
  Pavir.5KG667500.1.p  71 YQTNSGKILWDEKHKSLSAEIDRIKKENDTMQIELRHLKGEDLNSLQPKELIMIEEALDNGLTNLNEKLMEHWELHMRNNKMLEDENKLL 160
                          89999999********************************************************************************** PP

                K-box  91 nkaLrkk 97 
                            +L+++
  Pavir.5KG667500.1.p 161 AFKLHQQ 167
                          ***9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.333161IPR002100Transcription factor, MADS-box
SMARTSM004329.3E-43160IPR002100Transcription factor, MADS-box
CDDcd002653.41E-45280No hitNo description
SuperFamilySSF554558.89E-35296IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-30323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-303859IPR002100Transcription factor, MADS-box
PfamPF014867.6E-1482164IPR002487Transcription factor, K-box
PROSITE profilePS5129712.27984170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRNGILK KAREISVLCD AEVGVVIFSS AGKLYDFCSP  60
KTSLSKILEK YQTNSGKILW DEKHKSLSAE IDRIKKENDT MQIELRHLKG EDLNSLQPKE  120
LIMIEEALDN GLTNLNEKLM EHWELHMRNN KMLEDENKLL AFKLHQQDIA LSGSMRDLEL  180
GYHPDTDFAA QLPITFRVQP SHPNLQENN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-19171169Myocyte-specific enhancer factor 2B
1tqe_Q3e-19171169Myocyte-specific enhancer factor 2B
1tqe_R3e-19171169Myocyte-specific enhancer factor 2B
1tqe_S3e-19171169Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.144150.0callus| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2929590.0AJ292959.1 Zea mays mRNA for putative MADS-domain transcription factor (m16 gene).
GenBankBT0648490.0BT064849.1 Zea mays full-length cDNA clone ZM_BFb0210M20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970811.11e-152PREDICTED: MADS-box transcription factor 2
SwissprotQ407021e-147MADS2_ORYSJ; MADS-box transcription factor 2
TrEMBLK3XM061e-152K3XM06_SETIT; Uncharacterized protein
STRINGSi002929m1e-151(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-75MIKC_MADS family protein